Escherichia coli expression and purification of LL37 fused to a family III carbohydrate-binding module from Clostridium thermocellum
[Excerpt] Introduction: LL-37 ([LL-37, 37 aa]) is a very promising human cationic peptide with 37 aminoacids and α-helix structure. It has been shown to exhibit a broad spectrum of antimicrobial activity and to have additional defensive roles such as regulating the inflammator...
| Autor principal: | |
|---|---|
| Outros Autores: | , |
| Formato: | conferenceObject |
| Idioma: | eng |
| Publicado em: |
2010
|
| Assuntos: | |
| Texto completo: | http://hdl.handle.net/1822/33936 |
| País: | Portugal |
| Oai: | oai:repositorium.sdum.uminho.pt:1822/33936 |