Escherichia coli expression and purification of LL37 fused to a family III carbohydrate-binding module from Clostridium thermocellum
[Excerpt] Introduction: LL-37 ([LL-37, 37 aa]) is a very promising human cationic peptide with 37 aminoacids and α-helix structure. It has been shown to exhibit a broad spectrum of antimicrobial activity and to have additional defensive roles such as regulating the inflammator...
| Main Author: | |
|---|---|
| Other Authors: | , |
| Format: | conferenceObject |
| Language: | eng |
| Published: |
2010
|
| Subjects: | |
| Online Access: | http://hdl.handle.net/1822/33936 |
| Country: | Portugal |
| Oai: | oai:repositorium.sdum.uminho.pt:1822/33936 |