Escherichia coli expression and purification of LL37 fused to a family III carbohydrate-binding module from Clostridium thermocellum
[Excerpt] Introduction: LL-37 ([LL-37, 37 aa]) is a very promising human cationic peptide with 37 aminoacids and α-helix structure. It has been shown to exhibit a broad spectrum of antimicrobial activity and to have additional defensive roles such as regulating the inflammator...
Main Author: | |
---|---|
Other Authors: | , |
Format: | conferenceObject |
Language: | eng |
Published: |
2010
|
Subjects: | |
Online Access: | http://hdl.handle.net/1822/33936 |
Country: | Portugal |
Oai: | oai:repositorium.sdum.uminho.pt:1822/33936 |
Summary: | [Excerpt] Introduction: LL-37 ([LL-37, 37 aa]) is a very promising human cationic peptide with 37 aminoacids and α-helix structure. It has been shown to exhibit a broad spectrum of antimicrobial activity and to have additional defensive roles such as regulating the inflammatory response and chemo-attracting cells of the adaptative immune system to wound or infection sites, binding and neutralizing lipopolysaccharides (LPS), promoting angiogenesis, reepithelialization and wound closure. [...] |
---|